Content relative density | How prominently employed | Most-used keywords |
---|---|---|
No data yet | No data yet | Home |
No data yet | No data yet | Education |
No data yet | No data yet | Children's Centre Nursery |
No data yet | No data yet | Pheasey Park Farm |
Alexa ranking data | |
---|---|
Average statistics over the past month | |
Worldwide/Global rank: | 744820 |
Position delta: | +196960 |
Links to similar sites | |
Unavailable at this time | |
Global Alexa ranking over the past year | |
Webpage target region: | No data yet |
Rating according to reach: | No data yet |
Target country rank: | No data yet |
Alexa data updated on: | 2018-Jun-01 |
A closer look at the index page | |
---|---|
Number of external links | |
| |
Server proximity: | Dublin; L; Ireland |
Host IP: | 54.171.1.43 |
Tehcnologies used | |
---|---|
Google+ User ID: | Unavailable at this time |
Google Analytics code: | 88171084-1 |
ID for Google Adsense: | Unavailable at this time |
Known AddThis user account ID: | Unavailable at this time |
HTTP header data: |
---|
Vary: User-Agent
Cache-Control: no-cache
Pragma: no-cache
X-Wix-Server-Artifact-Id: wix-public-war
Date: Sun, 25 Feb 2018 13:35:55 GMT
X-Wix-Renderer-Server: app-jvm-21-0.84.wixprod.net
Set-Cookie: XSRF-TOKEN=1519565755|CqBnzboS01dn;Path=/;Domain=www.pheaseyparkfarmchildrenscentrenursery.co.uk
ETag: 56621063678c190c3b8324b756765260
Expires: Thu, 01 Jan 1970 00:00:00 GMT
Set-Cookie: svSession=b91fb7c705896492b6ed09768c84fe788d91c80dec74df47446667470a1e978464319bcbde51360b8952738a9518cd8a1e60994d53964e647acf431e4f798bcde6ab34b9f79743876d05d25e4f19fbd877016759ad92bf6be599c6d8e3f58f35;Path=/;Domain=www.pheaseyparkfarmchildrenscentrenursery.co.uk;Expires=Tue, 25-Feb-2020 13:35:54 GMT
Server: Pepyaka/1.13.7
HTTP/1.1 200 OK
X-Seen-By: BTnOiHJfychu5uLth4+AW8dGeYGpVyoUSMKAdIe0cbQ=,1wy2ILu/S4rlWT/R4rqCrVbmXE/o2wHC/BXzSPnkxYo=,LwsIp90Tma5sliyMxJYVEthWsKYOO1+wUWoDHg6PvM5YgeUJqUXtid+86vZww+nL,I2ZOrNA1LIowGTY6Ll7mx/ayVZxVTGytySOSc+GvWuU=,1wy2ILu/S4rlWT/R4rqCrV/JMDd4gilr2uGoEO7PurY=,Tw2AanFDQ+Wwo8Xxk6ZL7rHKeAJXtkPxqn+uc4aMlODq6NNL91a3Di10jVZVVuAn
transfer-encoding: chunked
Content-Type: text/html;charset=utf-8
Connection: keep-alive
Expires: -1
X-Wix-Request-Id: 1519565755.62631446020453025757
Set-Cookie: hs=-257059143;Path=/;Domain=www.pheaseyparkfarmchildrenscentrenursery.co.uk;HttpOnly
Content-Language: en
|
Contribute your opinion |
---|
Website security report | |
---|---|
Safe for Children: | No data yet |
Safety rank by Google: | No data yet |
WOT Trust Rank: | No data yet |
DNS | ||
---|---|---|
Hoest; NW; Germany; 47652 | 62.138.132.21 | ns2.123-reg.co.uk |
United Kingdom | 212.67.202.2 | ns.123-reg.co.uk |
Whois data overview | |
---|---|
Updated On (Date): | 2018-Feb-15 |
Expiration time: | No data yet |
Website Registered On (Date): | No data yet |
Whois data: | |
Error for "pheaseyparkfarmchildrenscentrenursery.co.uk". the WHOIS query quota for [EMAIL-HIDDEN] has been exceeded and will be replenished in 56 seconds WHOIS lookup made at 15:24:23 12-Feb-2018 -- This WHOIS information is provided for free by Nominet UK the central registry for .uk domain names. This information and the .uk WHOIS are: Copyright Nominet UK 1996 - 2018. You may not access the .uk WHOIS or use any data from it except as permitted by the terms of use available in full at http://www.nominet.uk/whoisterms, which includes restrictions on: (A) use of the data for advertising, or its repackaging, recompilation, redistribution or reuse (B) obscuring, removing or hiding any or all of this notice and (C) exceeding query rate or volume limits. The data is provided on an 'as-is' basis and may lag behind the register. Access may be withdrawn or restricted at any time. |